PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g29467.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 675aa    MW: 78264.2 Da    PI: 9.2455
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g29467.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR164.33.4e-2019106290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        Yn+Y    GFs+r s+s++s  ++e+ k+ fvC+k  k++ + kk+ k+ r+++ + t+Cka + ++++ +++w+v  +  eHnH+l 
  Bradi3g29467.1.p  19 HYNAYTLVKGFSIRSSTSRRSLYTNEVEKQLFVCNKFRKPKVDGKKAPKQIRRETIKGTNCKAGMIITLM-ESRWQVVYFIAEHNHPLI 106
                       6*********************************************999999******************.9***************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.0E-1719106IPR004330FAR1 DNA binding domain
PfamPF105516.1E-25232316IPR018289MULE transposase domain
PROSITE profilePS509669.013477512IPR007527Zinc finger, SWIM-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 675 aa     Download sequence    Send to blast
PHEPYLGMRY DTLLCAKNHY NAYTLVKGFS IRSSTSRRSL YTNEVEKQLF VCNKFRKPKV  60
DGKKAPKQIR RETIKGTNCK AGMIITLMES RWQVVYFIAE HNHPLITKPS LTKYLVSHQG  120
IPKEEENFLR ILHDSNLEIA SLSKKMPSLR HDIDSFCRAN DATNTISNYR SRMHAQTRGG  180
DMAETISYFT QKRLDDPDFY FIVLLDEEQR VQNLFWVDGA ARKAYEDDYS DCISFDTTYL  240
TNQYNMPFAP FIGINRHGQS FMLGCGFLRD EKATSFDWLF ETYLDAMHGK APQNIITDQD  300
WAMQASIAKH IMKKAQEKLG SLLGRRPELV GQFNEVVDYS LTPKEFEQSW TQMIAVHDVA  360
SNKHIAWLYN IRATWVPCYF KNCFFPFLQS TQRSEGFNVV LKRYGGNDYR TDHLQVRPWS  420
SYPIERQALN VYTRDIYYKF REQFEKIGRF NVRKLANDIY ELYPNRKYCC EYGTRTYKVT  480
ARVEEDSYSC ECCNQKDGLL CCHILKIFTH CSVDEIPQDY IMKRWTQQAI REEVAREEEK  540
PDVMPNQSVK EIRLANMSSE LQKVAREACG TDAGKQIVDK HVHAMHTELS HLKKTRKTPK  600
KAATTVPPAK TSTTAPSQPV DASAVRNPDR SATKGRTRKR RFENALELRP KRRNKCALCG  660
SKDHNQTTCP SKLV*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010233530.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0Q3GTY50.0A0A0Q3GTY5_BRADI; Uncharacterized protein
STRINGBRADI1G10750.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.15e-70FAR1-related sequence 5